PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do020321.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB_related
Protein Properties Length: 307aa    MW: 33413 Da    PI: 8.8306
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do020321.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.8e-142266147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +W++eE+ ++++a  ++G + Wk+I +++  ++t  q++s+ qky
       Do020321.1 22 REPWSPEEHGRFLNALLMFGRD-WKKIEEHVR-TKTTIQIRSHAQKY 66
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.56E-171672IPR009057Homeodomain-like
PROSITE profilePS5129417.4381771IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-71973IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-162069IPR006447Myb domain, plants
SMARTSM007177.9E-92169IPR001005SANT/Myb domain
PfamPF002496.7E-122266IPR001005SANT/Myb domain
CDDcd001673.23E-72467No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MERGNEMPGK KARKPYTITK PREPWSPEEH GRFLNALLMF GRDWKKIEEH VRTKTTIQIR  60
SHAQKYFLKV QKLGLATGLP PMHPRRRFAV EQQSSAAGSS AAAMPLLHGQ PQRAPVAEAP  120
GPSDGVAHGC IGWNSPVVLP AASSGKCLCQ SHSAEVRGLD WAGASASGPA AWLNSDAQSA  180
PPVTLPGGRR FIGASSLSST SMEWAGSSTS EGSAGGSVQD ELIELPLPPD DLHFAQVYRF  240
IGDIFDPNTT IPVEAHLQKL KDMDDITVKT ILLVLKNLEN NLSAPQFEPI RRLLSTYDPR  300
RGLFDQL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0693301e-66BT069330.2 Zea mays full-length cDNA clone ZM_BFc0100G09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971681.11e-160PREDICTED: protein REVEILLE 8-like isoform X2
TrEMBLC5XP981e-128C5XP98_SORBI; Putative uncharacterized protein Sb03g005480
STRINGSb03g005480.11e-128(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.21e-30MYB_related family protein